PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA60G00072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 169aa    MW: 18519.7 Da    PI: 8.4647
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA60G00072genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.55.3e-5532126195
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                 vreqdrflPian+srimk+ lP n+ki+kdak+tvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfe y+eplk+yl++yre ++
  AA60G00072  32 VREQDRFLPIANISRIMKRGLPPNGKIAKDAKDTVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFESYIEPLKIYLMRYREGDT 126
                 69*****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5228148IPR009072Histone-fold
SuperFamilySSF471138.23E-3935138IPR009072Histone-fold
PfamPF008081.4E-2738102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.6E-216684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.6E-2185103No hitNo description
PRINTSPR006152.6E-21104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MAESQNKSSG MSPGACGSHE SGGDQSPKSS QVREQDRFLP IANISRIMKR GLPPNGKIAK  60
DAKDTVQECV SEFISFVTSE ASDKCQREKR KTINGDDLLW AMATLGFESY IEPLKIYLMR  120
YREGDTKGSA KGGDMNAKKD VQSSQNGQFS QLAHQGSFSQ DPYGNSQIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-4733123494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-4733123494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530831e-135AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410886.11e-103hypothetical protein EUTSA_v10017301mg
SwissprotQ8VYK41e-100NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLE4MX361e-103E4MX36_EUTHA; mRNA, clone: RTFL01-13-K14
TrEMBLV4M7P81e-103V4M7P8_EUTSA; Uncharacterized protein
STRINGscaffold_402342.14e-99(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-102nuclear factor Y, subunit B8